PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10026001m
Common NameCARUB_v10026001mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family WRKY
Protein Properties Length: 692aa    MW: 74732.4 Da    PI: 6.5521
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10026001mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.31.2e-31271328260
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                      +DgynWrKYGqK vkgse+prsYY+Ct ++C+vkkkvers+ +++++ei+Y+g Hnh+k
  Carubv10026001m 271 EDGYNWRKYGQKLVKGSEYPRSYYKCTNPNCQVKKKVERSR-EGHITEIIYKGAHNHSK 328
                      8****************************************.***************85 PP

2WRKY103.89.3e-33492550159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      ldDgy+WrKYGqK+vkg+++prsYY+Ct +gC+v+k+ver+++d k v++tYeg+Hnh+
  Carubv10026001m 492 LDDGYRWRKYGQKVVKGNPNPRSYYKCTAPGCTVRKHVERASHDLKSVITTYEGKHNHD 550
                      59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.8E-28263329IPR003657WRKY domain
SuperFamilySSF1182904.97E-25268329IPR003657WRKY domain
SMARTSM007741.6E-34270328IPR003657WRKY domain
PfamPF031065.9E-24271326IPR003657WRKY domain
PROSITE profilePS5081123.25271329IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.0E-36477552IPR003657WRKY domain
SuperFamilySSF1182901.57E-28484552IPR003657WRKY domain
PROSITE profilePS5081138.136487552IPR003657WRKY domain
SMARTSM007741.8E-37492551IPR003657WRKY domain
PfamPF031068.9E-25493550IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0009942Biological Processlongitudinal axis specification
GO:0030010Biological Processestablishment of cell polarity
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 692 aa     Download sequence    Send to blast
MAGFDKNIAV MGEWVPRSRS PSPGELLSSA IGEGKGTKRV LERELSLNHG QVTGVEVDTT  60
GNHNKDSSQT NVSRGCLSER IAARAGFNAP RLNTENIRSN TNFSIDSSPC LTISSPGLSP  120
ATLLESPVFL SNPMAQPSPT TGKFPFLPGF NSNALSSDKA KDEFFDDIGA SFTFQSVSRS  180
SSSFFQGTTE MMSAEYGNYN NRSSHQPADE DVKPGSQNIE SSNLYGIETD PSGQNKTSDA  240
TTNTGLETVD HQEEEEDQRR GDSMVGGAPA EDGYNWRKYG QKLVKGSEYP RSYYKCTNPN  300
CQVKKKVERS REGHITEIIY KGAHNHSKPL PNRRSGMQTD GTEQVEQQQQ QQQQQRDSAG  360
TWVSCNNAQQ QGGSNVNNVE ERSTRFEYGN QSGVIQAQTG GQYDSGEAVV VVDTSSTFSN  420
DEDEDDRGTH GSVSLGCDGG AGGGGGGGGG EGEESESKRR KLEAYAAEMS GATRAIREPR  480
VVVQTTSDVD ILDDGYRWRK YGQKVVKGNP NPRSYYKCTA PGCTVRKHVE RASHDLKSVI  540
TTYEGKHNHD VPAARNSSHG GGGGSSGGSA AASHHYNNVH HSEQSRGRFD RQVTTTHHQS  600
PYGRPFTFQP HLGPPSGYAF GLGQNGLANL SMPGLAFGQG KMPGLPHQYL TQQPVGMNEA  660
MMQRGMEPKA EPVSDSGQSV YNQIMSRLPQ I*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A3e-37271553878Probable WRKY transcription factor 4
1wj2_A3e-37271553878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00071PBMTransfer from AT5G56270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4183080.0AF418308.1 Arabidopsis thaliana WRKY transcription factor 2 (WRKY2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006280109.10.0hypothetical protein CARUB_v10026001mg
SwissprotQ9FG770.0WRKY2_ARATH; Probable WRKY transcription factor 2
TrEMBLR0EV690.0R0EV69_9BRAS; Uncharacterized protein
STRINGscaffold_802171.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79542740
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.10.0WRKY DNA-binding protein 2